PDB entry 1i96

View 1i96 on RCSB PDB site
Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the translation initiation factor if3 (c-terminal domain)
Deposited on 2001-03-18, released 2001-04-12
The last revision prior to the SCOP 1.63 freeze date was dated 2001-04-12, with a file datestamp of 2001-04-12.
Experiment type: XRAY
Resolution: 4.2 Å
R-factor: 0.205
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Domains in SCOP 1.63: d1i96b_
  • Chain 'C':
    Domains in SCOP 1.63: d1i96c1, d1i96c2
  • Chain 'D':
    Domains in SCOP 1.63: d1i96d_
  • Chain 'E':
    Domains in SCOP 1.63: d1i96e1, d1i96e2
  • Chain 'F':
    Domains in SCOP 1.63: d1i96f_
  • Chain 'G':
    Domains in SCOP 1.63: d1i96g_
  • Chain 'H':
    Domains in SCOP 1.63: d1i96h_
  • Chain 'I':
    Domains in SCOP 1.63: d1i96i_
  • Chain 'J':
    Domains in SCOP 1.63: d1i96j_
  • Chain 'K':
    Domains in SCOP 1.63: d1i96k_
  • Chain 'L':
    Domains in SCOP 1.63: d1i96l_
  • Chain 'M':
    Domains in SCOP 1.63: d1i96m_
  • Chain 'N':
    Domains in SCOP 1.63: d1i96n_
  • Chain 'O':
    Domains in SCOP 1.63: d1i96o_
  • Chain 'P':
    Domains in SCOP 1.63: d1i96p_
  • Chain 'Q':
    Domains in SCOP 1.63: d1i96q_
  • Chain 'R':
    Domains in SCOP 1.63: d1i96r_
  • Chain 'S':
    Domains in SCOP 1.63: d1i96s_
  • Chain 'T':
    Domains in SCOP 1.63: d1i96t_
  • Chain 'U':
    Domains in SCOP 1.63: d1i96u_
  • Chain 'V':
    Domains in SCOP 1.63: d1i96v_

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i96B (B:)
    pveitvkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedl
    amrggtilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleeleal
    faspeieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklf
    ipvialadtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvqe
    aeatetpeg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i96C (C:)
    gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
    dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqevqnpnlsaplvaqrva
    eqierrfavrraikqavqrvmesgakgakvivsgriggaeqartewaaqgrvplhtlran
    idygfalarttygvlgvkayiflgev
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i96D (D:)
    gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
    qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
    rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
    kgkflrlpdredlalpvneqlviefysr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i96E (E:)
    petdfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyy
    arrnmvevplqngtipheievefgaskivlkpaapgtgviagavprailelagvtdiltk
    elgsrnpiniayatmealrqlrtkadverlrkgeah
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i96F (F:)
    mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
    lwyqvempedrvndlarelrirdnvrrvmvvksqepflana
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i96G (G:)
    arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
    fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
    helmdaaegkggavkkkedvermaeanrayahyrw
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i96H (H:)
    mltdpiadmltrirnatrvykestevpasrfkeeilkilaregfikgyervevdgkpylr
    ihlkygprrqgpdprpeqvikhirrisrpgrrvyvgvkeiprvrrglgiailstpkgvlt
    drearklgvggelicevw
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i96I (I:)
    eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
    yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
    apqyskr
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i96J (J:)
    kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
    felrthnrlvdiinpnrktieqlmtldlptgveieikt
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i96K (K:)
    kkkvkrqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaal
    daakkamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfr
    kas
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i96L (L:)
    ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
    evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
    pkeaaktaakk
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i96M (M:)
    ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
    ntwklegelraevaanikrlmdigcyrglrhrr
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i96N (N:)
    arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i96O (O:)
    pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
    qrrrllrylqredperyralieklgirg
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i96P (P:)
    mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
    svgaqptdtarrllrqagvfrqearega
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i96Q (Q:)
    pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeerykvgdvveiie
    arpiskrkrfrvlrlveegrldlvekylvrrqnyaslskrggka
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i96R (R:)
    kpkkeaqrrpsrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqril
    aktikrarilgllpfteklvrk
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i96S (S:)
    prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
    itenmvghklgefaptrtyr
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i96T (T:)
    rnlsalkrhrqslkrrlrnkakksaiktlskkaiqlaqegkaeealkimrkaeslidkaa
    kgstlhknaaarrksrlmrkvrqlleaagapliggglsa
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i96U (U:)
    gkgdrrtrrgkiwrgtygkyrprk
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i96V (V:)
    evksikfrvkidehdyqtklghikrflqeghkvkvtimfrgrevahpelgerilnrvted
    lkdlavvemkpemlgrdmnmllapvk