PDB entry 1i94

View 1i94 on RCSB PDB site
Description: crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
Deposited on 2001-03-18, released 2001-04-12
The last revision prior to the SCOP 1.71 freeze date was dated 2001-04-12, with a file datestamp of 2001-04-12.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.203
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Domains in SCOP 1.71: d1i94b_
  • Chain 'C':
    Domains in SCOP 1.71: d1i94c1, d1i94c2
  • Chain 'D':
    Domains in SCOP 1.71: d1i94d_
  • Chain 'E':
    Domains in SCOP 1.71: d1i94e1, d1i94e2
  • Chain 'F':
    Domains in SCOP 1.71: d1i94f_
  • Chain 'G':
    Domains in SCOP 1.71: d1i94g_
  • Chain 'H':
    Domains in SCOP 1.71: d1i94h_
  • Chain 'I':
    Domains in SCOP 1.71: d1i94i_
  • Chain 'J':
    Domains in SCOP 1.71: d1i94j_
  • Chain 'K':
    Domains in SCOP 1.71: d1i94k_
  • Chain 'L':
    Domains in SCOP 1.71: d1i94l_
  • Chain 'M':
    Domains in SCOP 1.71: d1i94m_
  • Chain 'N':
    Domains in SCOP 1.71: d1i94n_
  • Chain 'O':
    Domains in SCOP 1.71: d1i94o_
  • Chain 'P':
    Domains in SCOP 1.71: d1i94p_
  • Chain 'Q':
    Domains in SCOP 1.71: d1i94q_
  • Chain 'R':
    Domains in SCOP 1.71: d1i94r_
  • Chain 'S':
    Domains in SCOP 1.71: d1i94s_
  • Chain 'T':
    Domains in SCOP 1.71: d1i94t_
  • Chain 'U':
    Domains in SCOP 1.71: d1i94u_

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1i94B (B:)
    pveitvkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedl
    amrggtilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleeleal
    faspeieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklf
    ipvialadtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvqe
    aeatetpegesevea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i94B (B:)
    pveitvkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedl
    amrggtilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleeleal
    faspeieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklf
    ipvialadtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvqe
    aeatetpeg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1i94C (C:)
    gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
    dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqevqnpnlsaplvaqrva
    eqierrfavrraikqavqrvmesgakgakvivsgriggaeqartewaaqgrvplhtlran
    idygfalarttygvlgvkayiflgeviggqkpkarpelpkaeerprrrrpavrvkkee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i94C (C:)
    gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
    dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqevqnpnlsaplvaqrva
    eqierrfavrraikqavqrvmesgakgakvivsgriggaeqartewaaqgrvplhtlran
    idygfalarttygvlgvkayiflgev
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i94D (D:)
    gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
    qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
    rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
    kgkflrlpdredlalpvneqlviefysr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1i94E (E:)
    petdfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyy
    arrnmvevplqngtipheievefgaskivlkpaapgtgviagavprailelagvtdiltk
    elgsrnpiniayatmealrqlrtkadverlrkgeahaqaqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i94E (E:)
    petdfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyy
    arrnmvevplqngtipheievefgaskivlkpaapgtgviagavprailelagvtdiltk
    elgsrnpiniayatmealrqlrtkadverlrkgeah
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i94F (F:)
    mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
    lwyqvempedrvndlarelrirdnvrrvmvvksqepflana
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i94G (G:)
    arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
    fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
    helmdaaegkggavkkkedvermaeanrayahyrw
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i94H (H:)
    mltdpiadmltrirnatrvykestevpasrfkeeilkilaregfikgyervevdgkpylr
    ihlkygprrqgpdprpeqvikhirrisrpgrrvyvgvkeiprvrrglgiailstpkgvlt
    drearklgvggelicevw
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1i94I (I:)
    meqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfd
    ayitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkar
    rapqyskr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i94I (I:)
    eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
    yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
    apqyskr
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1i94J (J:)
    pkiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsre
    hfelrthnrlvdiinpnrktieqlmtldlptgveieiktvgggr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i94J (J:)
    kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
    felrthnrlvdiinpnrktieqlmtldlptgveieikt
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1i94K (K:)
    akkpskkkvkrqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaa
    qlaaldaakkamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrp
    kkkfrkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i94K (K:)
    kkkvkrqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaal
    daakkamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfr
    kas
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i94L (L:)
    ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
    evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
    pkeaaktaakk
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1i94M (M:)
    ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
    ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk
    kaprk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i94M (M:)
    ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
    ntwklegelraevaanikrlmdigcyrglrhrr
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i94N (N:)
    arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i94O (O:)
    pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
    qrrrllrylqredperyralieklgirg
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i94P (P:)
    mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
    svgaqptdtarrllrqagvfrqearega
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i94Q (Q:)
    pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeerykvgdvveiie
    arpiskrkrfrvlrlveegrldlvekylvrrqnyaslskrggka
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1i94R (R:)
    stknakpkkeaqrrpsrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgk
    eqrilaktikrarilgllpfteklvrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i94R (R:)
    kpkkeaqrrpsrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqril
    aktikrarilgllpfteklvrk
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1i94S (S:)
    prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
    itenmvghklgefaptrtyrghgkeakatkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i94S (S:)
    prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
    itenmvghklgefaptrtyr
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1i94T (T:)
    aqkkpkrnlsalkrhrqslkrrlrnkakksaiktlskkaiqlaqegkaeealkimrkaes
    lidkaakgstlhknaaarrksrlmrkvrqlleaagapliggglsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i94T (T:)
    rnlsalkrhrqslkrrlrnkakksaiktlskkaiqlaqegkaeealkimrkaeslidkaa
    kgstlhknaaarrksrlmrkvrqlleaagapliggglsa
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >1i94U (U:)
    gkgdrrtrrgkiwrgtygkyrprkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i94U (U:)
    gkgdrrtrrgkiwrgtygkyrprk