PDB entry 1i8v

View 1i8v on RCSB PDB site
Description: crystal structure of RNAse sa y80f mutant
Class: hydrolase
Keywords: mutant, HYDROLASE
Deposited on 2001-03-16, released 2001-09-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.132
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: guanyl-specific ribonuclease sa
  Species: Streptomyces aureofaciens [TaxId:1894]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05798 (0-95)
    • see remark 999 (71)
    • engineered (79)
  Domains in SCOPe 2.05: d1i8va_
• Chain 'B':
  Compound: guanyl-specific ribonuclease sa
  Species: Streptomyces aureofaciens [TaxId:1894]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05798 (0-95)
    • see remark 999 (71)
    • engineered (79)
  Domains in SCOPe 2.05: d1i8vb_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1i8vA (A:)
  dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
  gartrgtrriitgeatqedfytgdhyatfslidqtc
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1i8vB (B:)
  dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
  gartrgtrriitgeatqedfytgdhyatfslidqtc