PDB entry 1i8v

View 1i8v on RCSB PDB site
Description: crystal structure of RNAse sa y80f mutant
Class: hydrolase
Keywords: mutant
Deposited on 2001-03-16, released 2001-09-19
The last revision prior to the SCOP 1.73 freeze date was dated 2001-09-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.132
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: guanyl-specific ribonuclease sa
    Species: Streptomyces aureofaciens
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05798 (0-95)
      • see remark 999 (71)
      • engineered (79)
    Domains in SCOP 1.73: d1i8va_
  • Chain 'B':
    Compound: guanyl-specific ribonuclease sa
    Species: Streptomyces aureofaciens
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05798 (0-95)
      • see remark 999 (71)
      • engineered (79)
    Domains in SCOP 1.73: d1i8vb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i8vA (A:)
    dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
    gartrgtrriitgeatqedfytgdhyatfslidqtc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i8vB (B:)
    dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
    gartrgtrriitgeatqedfytgdhyatfslidqtc