PDB entry 1i8q

View 1i8q on RCSB PDB site
Description: crystal structure of streptococcus agalactiae hyaluronate lyase complexed with enzyme product, unsaturated disaccharide hyaluronan
Class: lyase
Keywords: beta-alpha-beta, LYASE
Deposited on 2001-03-15, released 2002-01-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.182
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hyaluronate lyase
    Species: STREPTOCOCCUS AGALACTIAE [TaxId:1311]
    Gene: HYL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53591 (0-813)
      • see remark 999 (75)
      • see remark 999 (77)
      • see remark 999 (109)
      • see remark 999 (117)
      • see remark 999 (412)
      • see remark 999 (517-518)
      • see remark 999 (711)
      • see remark 999 (723)
    Domains in SCOPe 2.05: d1i8qa1, d1i8qa2, d1i8qa3, d1i8qa4
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i8qA (A:)
    sehpqpvttqieksvntalnknyvfnkadyqytltnpslgkivggilypnatgsttvkis
    dksgkiikevplsvtastednftklldkwndvtignyvydtndsnmqklnqkldetnakn
    ieaikldsnrtflwkdldnlnnsaqltatyrrledlakqitnphstiyknekairtvkes
    lawlhqnfynvnkdiegsanwwdfeigvprsitgtlslmnnyftdaeiktytdpiehfvp
    daeyfrktlvnpfkalggnlvdmgrvkiiegllrkdntiiektshslknlfttatkaegf
    yadgsyidhtnvaytgaygnvlidgltqllpiiqetdykisnqeldmvykwinqsflpli
    vkgelmdmsrgrsisreaasshaaavevlrgflrlanmsneernldlkstiktiitsnkf
    ynvfnnlksysdianmnkllndstvatkplksnlstfnsmdrlayynakkdfgfalslhs
    krtlnyegmndentrgwytgdgmfyiynsdqshysnhfwptvnpykmagttekdakredt
    tkefmskhskdakektgqvtgtsdfvgsvklndhfalaamdftnwdrtltaqkgwvilnd
    kivflgsnikntngignvsttidqrkddsktpyttyvngktidlkqassqqftdtksvfl
    eskepgrnigyiffknstidierkeqtgtwnsinrtskntsivsnpfitisqkhdnkgds
    ygymmvpnidrtsfdklanskevellensskqqviydknsqtwavikhdnqeslinnqfk
    mnkaglylvqkvgndyqnvyyqpqtmtktdqlai