PDB entry 1i8m

View 1i8m on RCSB PDB site
Description: crystal structure of a recombinant anti-single-stranded DNA antibody fragment complexed with dt5
Class: immune system/DNA
Keywords: fab, antibody, anti-DNA antibody, autoantibody, lupus, IMMUNE SYSTEM-DNA COMPLEX
Deposited on 2001-03-14, released 2001-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody light chain fab
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAC28909 (0-End)
    Domains in SCOPe 2.07: d1i8ma1, d1i8ma2
  • Chain 'B':
    Compound: antibody heavy chain fab
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAC28908 (4-End)
      • cloning artifact (0-3)
    Domains in SCOPe 2.07: d1i8mb1, d1i8mb2, d1i8mb3
  • Chain 'D':
    Compound: 5'-d(p*tp*t)-3'
  • Chain 'H':
    Compound: antibody heavy chain fab
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAC28908 (4-End)
      • cloning artifact (0-3)
    Domains in SCOPe 2.07: d1i8mh1, d1i8mh2, d1i8mh3
  • Chain 'L':
    Compound: antibody light chain fab
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAC28909 (0-End)
    Domains in SCOPe 2.07: d1i8ml1, d1i8ml2
  • Chain 'T':
    Compound: 5'-d(*tp*tp*tp*tp*t)-3'
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i8mA (A:)
    elqmtqspaslsasvgetvtitcraseniysylawyqqkqgkspqllvynaktlaegvps
    rfsgsgsgtqfslkinslqpedfgsyycqhhygtpltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i8mA (A:)
    elqmtqspaslsasvgetvtitcraseniysylawyqqkqgkspqllvynaktlaegvps
    rfsgsgsgtqfslkinslqpedfgsyycqhhygtpltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1i8mB (B:)
    qvkllesgpelvkpgasvkmsckasgytftsyvmhwvkqkpgqglewigyinpyndgtky
    nekfkgkatltsdkssstaymelssltsedsavyycvrggyrpyyamdywgqgtsvtvss
    akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdcts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i8mB (B:)
    qvkllesgpelvkpgasvkmsckasgytftsyvmhwvkqkpgqglewigyinpyndgtky
    nekfkgkatltsdkssstaymelssltsedsavyycvrggyrpyyamdywgqgtsvtvss
    akttppsvyplapsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsss
    vtvpsstwpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'D':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1i8mH (H:)
    qvkllesgpelvkpgasvkmsckasgytftsyvmhwvkqkpgqglewigyinpyndgtky
    nekfkgkatltsdkssstaymelssltsedsavyycvrggyrpyyamdywgqgtsvtvss
    akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdcts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i8mH (H:)
    qvkllesgpelvkpgasvkmsckasgytftsyvmhwvkqkpgqglewigyinpyndgtky
    nekfkgkatltsdkssstaymelssltsedsavyycvrggyrpyyamdywgqgtsvtvss
    akttppsvyplapsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsss
    vtvpsstwpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1i8mL (L:)
    elqmtqspaslsasvgetvtitcraseniysylawyqqkqgkspqllvynaktlaegvps
    rfsgsgsgtqfslkinslqpedfgsyycqhhygtpltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i8mL (L:)
    elqmtqspaslsasvgetvtitcraseniysylawyqqkqgkspqllvynaktlaegvps
    rfsgsgsgtqfslkinslqpedfgsyycqhhygtpltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'T':
    No sequence available.