PDB entry 1i8k

View 1i8k on RCSB PDB site
Description: crystal structure of dsfv mr1 in complex with the peptide antigen of the mutant epidermal growth factor receptor, egfrviii, at liquid nitrogen temperature
Class: immune system
Keywords: antibody-peptide complex, immunoglobulin fold, peptide antigen, type II' beta turn., IMMUNE SYSTEM
Deposited on 2001-03-14, released 2002-03-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.172
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: epidermal growth factor receptor antibody mr1scfv light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8R028 (0-End)
      • engineered (99)
    Domains in SCOPe 2.06: d1i8ka_
  • Chain 'B':
    Compound: epidermal growth factor receptor antibody mr1scfv heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18529 (0-End)
      • engineered (43)
    Domains in SCOPe 2.06: d1i8kb_
  • Chain 'C':
    Compound: epidermal growth factor receptor, egfrviii peptide antigen
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1I8K (Start-11)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i8kA (A:)
    dieltqspaslsvatgekvtircmtstdidddmnwyqqkpgeppkflisegntlrpgvps
    rfsssgtgtdfvftientlsedvgdyyclqsfnvpltfgcgtkleik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i8kA (A:)
    dieltqspaslsvatgekvtircmtstdidddmnwyqqkpgeppkflisegntlrpgvps
    rfsssgtgtdfvftientlsedvgdyyclqsfnvpltfgcgtklei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1i8kB (B:)
    qvklqqsggglvkpgaslklscvtsgftfrkfgmswvrqtsdkclewvasistggyntyy
    sdnvkgrftisrenakntlylqmsslksedtalyyctrgysstsyamdywgqgttvtvsg
    iegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i8kB (B:)
    qvklqqsggglvkpgaslklscvtsgftfrkfgmswvrqtsdkclewvasistggyntyy
    sdnvkgrftisrenakntlylqmsslksedtalyyctrgysstsyamdywgqgttvtvs
    

  • Chain 'C':
    No sequence available.