PDB entry 1i8k

View 1i8k on RCSB PDB site
Description:
Deposited on 2001-03-14, released 2002-03-14
The last revision prior to the SCOP 1.65 freeze date was dated 2002-03-14, with a file datestamp of 2002-03-14.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.172
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1i8ka_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1i8kb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i8kA (A:)
    dieltqspaslsvatgekvtircmtstdidddmnwyqqkpgeppkflisegntlrpgvps
    rfsssgtgtdfvftientlsedvgdyyclqsfnvpltfgcgtkleik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i8kA (A:)
    dieltqspaslsvatgekvtircmtstdidddmnwyqqkpgeppkflisegntlrpgvps
    rfsssgtgtdfvftientlsedvgdyyclqsfnvpltfgcgtklei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1i8kB (B:)
    qvklqqsggglvkpgaslklscvtsgftfrkfgmswvrqtsdkclewvasistggyntyy
    sdnvkgrftisrenakntlylqmsslksedtalyyctrgysstsyamdywgqgttvtvsg
    iegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i8kB (B:)
    qvklqqsggglvkpgaslklscvtsgftfrkfgmswvrqtsdkclewvasistggyntyy
    sdnvkgrftisrenakntlylqmsslksedtalyyctrgysstsyamdywgqgttvtvs