PDB entry 1i8j

View 1i8j on RCSB PDB site
Description: crystal structure of porphobilinogen synthase complexed with the inhibitor 4,7-dioxosebacic acid
Deposited on 2001-03-14, released 2001-06-20
The last revision prior to the SCOP 1.65 freeze date was dated 2001-08-01, with a file datestamp of 2001-08-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.198
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1i8ja_
  • Chain 'B':
    Domains in SCOP 1.65: d1i8jb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i8jA (A:)
    tdliqrprrlrkspalramfeettlslndlvlpifveeeiddykaveampgvmripekhl
    areierianagirsvmtfgishhtdetgsdawredglvarmsrickqtvpemivmsdtcf
    ceytshghcgvlcehgvdndatlenlgkqavvaaaagadfiapsaamdgqvqairqalda
    agfkdtaimsystkfassfygpfreaagsalkgdrksyqmnpmnrreaireslldeaqga
    dclmvkpagayldivrelrertelpigayqvsgeyamikfaalagaideekvvleslgsi
    kragadlifsyfaldlaekkilr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i8jB (B:)
    tdliqrprrlrkspalramfeettlslndlvlpifveeeiddykaveampgvmripekhl
    areierianagirsvmtfgishhtdetgsdawredglvarmsrickqtvpemivmsdtcf
    ceytshghcgvlcehgvdndatlenlgkqavvaaaagadfiapsaamdgqvqairqalda
    agfkdtaimsystkfassfygpfreaagsalkgdrksyqmnpmnrreaireslldeaqga
    dclmvkpagayldivrelrertelpigayqvsgeyamikfaalagaideekvvleslgsi
    kragadlifsyfaldlaekkilr