PDB entry 1i8d

View 1i8d on RCSB PDB site
Description: crystal structure of riboflavin synthase
Class: transferase
Keywords: riboflavin synthase, riboflavin biosynthesis, antimicrobial target, structure-based design, Escherichia coli
Deposited on 2001-03-13, released 2001-09-19
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: riboflavin synthase
    Species: Escherichia coli
    Gene: BACTERIA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1i8da1, d1i8da2
  • Chain 'B':
    Compound: riboflavin synthase
    Species: Escherichia coli
    Gene: BACTERIA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1i8db1, d1i8db2
  • Chain 'C':
    Compound: riboflavin synthase
    Species: Escherichia coli
    Gene: BACTERIA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1i8dc1, d1i8dc2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i8dA (A:)
    mftgivqgtaklvsidekpnfrthvvelpdhmldgletgasvahngccltvteingnhvs
    fdlmketlritnlgdlkvgdwvnveraakfsdeigghlmsghimttaevakiltsennrq
    iwfkvqdsqlmkyilykgfigidgisltvgevtptrfcvhlipetlerttlgkkklgarv
    nieidpqtqavvdtvervlaarenamnqpgtea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i8dA (A:)
    mftgivqgtaklvsidekpnfrthvvelpdhmldgletgasvahngccltvteingnhvs
    fdlmketlritnlgdlkvgdwvnveraakfsdeigghlmsghimttaevakiltsennrq
    iwfkvqdsqlmkyilykgfigidgisltvgevtptrfcvhlipetlerttlgkkklgarv
    nieidpqtqavvdtvervlaarenam
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1i8dB (B:)
    mftgivqgtaklvsidekpnfrthvvelpdhmldgletgasvahngccltvteingnhvs
    fdlmketlritnlgdlkvgdwvnveraakfsdeigghlmsghimttaevakiltsennrq
    iwfkvqdsqlmkyilykgfigidgisltvgevtptrfcvhlipetlerttlgkkklgarv
    nieidpqtqavvdtvervlaarenamnqpgtea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i8dB (B:)
    mftgivqgtaklvsidekpnfrthvvelpdhmldgletgasvahngccltvteingnhvs
    fdlmketlritnlgdlkvgdwvnveraakfsdeigghlmsghimttaevakilrqiwfkv
    qdsqlmkyilykgfigidgisltvgevtptrfcvhlipetlerttlgkkklgarvnieid
    pqtqavvdtvervlaarenam
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1i8dC (C:)
    mftgivqgtaklvsidekpnfrthvvelpdhmldgletgasvahngccltvteingnhvs
    fdlmketlritnlgdlkvgdwvnveraakfsdeigghlmsghimttaevakiltsennrq
    iwfkvqdsqlmkyilykgfigidgisltvgevtptrfcvhlipetlerttlgkkklgarv
    nieidpqtqavvdtvervlaarenamnqpgtea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i8dC (C:)
    mftgivqgtaklvsidekpnfrthvvelpdhmldgletgasvahngccltvteingnhvs
    fdlmketlritnlgdlkvgdwvnveraakfhlmsghimttaevaiwfkvqdsqlmkyily
    kgfigidgisltvgevtptrfcvhlipetlerttlgkkklgarvnieidpqtqavvdtve
    rvlaa