PDB entry 1i8d

View 1i8d on RCSB PDB site
Description: crystal structure of riboflavin synthase
Deposited on 2001-03-13, released 2001-09-19
The last revision prior to the SCOP 1.57 freeze date was dated 2001-09-19, with a file datestamp of 2001-09-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i8dA (A:)
    mftgivqgtaklvsidekpnfrthvvelpdhmldgletgasvahngccltvteingnhvs
    fdlmketlritnlgdlkvgdwvnveraakfsdeigghlmsghimttaevakiltsennrq
    iwfkvqdsqlmkyilykgfigidgisltvgevtptrfcvhlipetlerttlgkkklgarv
    nieidpqtqavvdtvervlaarenam
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1i8dB (B:)
    mftgivqgtaklvsidekpnfrthvvelpdhmldgletgasvahngccltvteingnhvs
    fdlmketlritnlgdlkvgdwvnveraakfsdeigghlmsghimttaevakiltsennrq
    iwfkvqdsqlmkyilykgfigidgisltvgevtptrfcvhlipetlerttlgkkklgarv
    nieidpqtqavvdtvervlaarenam
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i8dB (B:)
    mftgivqgtaklvsidekpnfrthvvelpdhmldgletgasvahngccltvteingnhvs
    fdlmketlritnlgdlkvgdwvnveraakfsdeigghlmsghimttaevakilrqiwfkv
    qdsqlmkyilykgfigidgisltvgevtptrfcvhlipetlerttlgkkklgarvnieid
    pqtqavvdtvervlaarenam
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1i8dC (C:)
    mftgivqgtaklvsidekpnfrthvvelpdhmldgletgasvahngccltvteingnhvs
    fdlmketlritnlgdlkvgdwvnveraakfsdeigghlmsghimttaevakiltsennrq
    iwfkvqdsqlmkyilykgfigidgisltvgevtptrfcvhlipetlerttlgkkklgarv
    nieidpqtqavvdtvervlaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i8dC (C:)
    mftgivqgtaklvsidekpnfrthvvelpdhmldgletgasvahngccltvteingnhvs
    fdlmketlritnlgdlkvgdwvnveraakfhlmsghimttaevaiwfkvqdsqlmkyily
    kgfigidgisltvgevtptrfcvhlipetlerttlgkkklgarvnieidpqtqavvdtve
    rvlaa