PDB entry 1i8c

View 1i8c on RCSB PDB site
Description: solution structure of the water-soluble fragment of rat hepatic apocytochrome b5
Deposited on 2001-03-13, released 2001-05-16
The last revision prior to the SCOP 1.67 freeze date was dated 2001-05-16, with a file datestamp of 2001-05-16.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1i8ca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i8cA (A:)
    aeqsdkdvkyytleeiqkhkdskstwvilhhkvydltkfleehpggeevlreqaggdate
    nfedvghstdarelsktyiigelhpddrskiakpsetl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i8cA (A:)
    dkdvkyytleeiqkhkdskstwvilhhkvydltkfleehpggeevlreqaggdatenfed
    vghstdarelsktyiigelhpddrskiakpsetl