PDB entry 1i80

View 1i80 on RCSB PDB site
Description: crystal structure of m. tuberculosis pnp in complex with iminoribitol, 9-deazahypoxanthine and phosphate ion
Deposited on 2001-03-12, released 2001-08-01
The last revision prior to the SCOP 1.67 freeze date was dated 2001-08-01, with a file datestamp of 2001-08-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1i80a_
  • Chain 'B':
    Domains in SCOP 1.67: d1i80b_
  • Chain 'C':
    Domains in SCOP 1.67: d1i80c_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i80A (A:)
    madprpdpdelarraaqviadrtgigehdvavvlgsgwlpavaalgspttvlpqaelpgf
    vpptaaghagellsvpigahrvlvlagrihayeghdlryvvhpvraaraagaqimvltna
    agglradlqvgqpvlisdhlnltarsplvggefvdltdaysprlrelarqsdpqlaegvy
    aglpgphyetpaeirmlqtlgadlvgmstvhetiaaraagaevlgvslvtnlaagitgep
    lshaevlaagaasatrmgalladviarf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i80A (A:)
    dprpdpdelarraaqviadrtgigehdvavvlgsgwlpavaalgspttvlpqaelpgfvp
    ptaaghagellsvpigahrvlvlagrihayeghdlryvvhpvraaraagaqimvltnaag
    glradlqvgqpvlisdhlnltarsplvggefvdltdaysprlrelarqsdpqlaegvyag
    lpgphyetpaeirmlqtlgadlvgmstvhetiaaraagaevlgvslvtnlaagitgepls
    haevlaagaasatrmgalladviarf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1i80B (B:)
    madprpdpdelarraaqviadrtgigehdvavvlgsgwlpavaalgspttvlpqaelpgf
    vpptaaghagellsvpigahrvlvlagrihayeghdlryvvhpvraaraagaqimvltna
    agglradlqvgqpvlisdhlnltarsplvggefvdltdaysprlrelarqsdpqlaegvy
    aglpgphyetpaeirmlqtlgadlvgmstvhetiaaraagaevlgvslvtnlaagitgep
    lshaevlaagaasatrmgalladviarf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i80B (B:)
    pdpdelarraaqviadrtgigehdvavvlgsgwlpavaalgspttvlpqaelpgfvppta
    aghagellsvpigahrvlvlagrihayeghdlryvvhpvraaraagaqimvltnaagglr
    adlqvgqpvlisdhlnltarsplvggefvdltdaysprlrelarqsdpqlaegvyaglpg
    phyetpaeirmlqtlgadlvgmstvhetiaaraagaevlgvslvtnlaagitgeplshae
    vlaagaasatrmgalladviarf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1i80C (C:)
    madprpdpdelarraaqviadrtgigehdvavvlgsgwlpavaalgspttvlpqaelpgf
    vpptaaghagellsvpigahrvlvlagrihayeghdlryvvhpvraaraagaqimvltna
    agglradlqvgqpvlisdhlnltarsplvggefvdltdaysprlrelarqsdpqlaegvy
    aglpgphyetpaeirmlqtlgadlvgmstvhetiaaraagaevlgvslvtnlaagitgep
    lshaevlaagaasatrmgalladviarf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i80C (C:)
    dpdelarraaqviadrtgigehdvavvlgsgwlpavaalgspttvlpqaelpgfvpptaa
    ghagellsvpigahrvlvlagrihayeghdlryvvhpvraaraagaqimvltnaagglra
    dlqvgqpvlisdhlnltarsplvggefvdltdaysprlrelarqsdpqlaegvyaglpgp
    hyetpaeirmlqtlgadlvgmstvhetiaaraagaevlgvslvtnlaagitgeplshaev
    laagaasatrmgalladviarf