PDB entry 1i7z

View 1i7z on RCSB PDB site
Description: antibody gnc92h2 bound to ligand
Deposited on 2001-03-12, released 2001-08-08
The last revision prior to the SCOP 1.57 freeze date was dated 2001-08-08, with a file datestamp of 2001-08-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.22
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i7zA (A:)
    dlvltqspaslavslgqratiscrasksvstsgynymhwyqqkpgqppklliylasnlas
    gvparfsgsgsgtdftlnihpveeedaatyyclysrefppwtfgggtkleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i7zB (B:)
    qvqlqqsgpelkkpgetvkiscktsgysftnygmnwvkqapgkglkwmgwintytgepty
    addfrgrfafslatsastaylqiinlknedtatyfcetydsplgdywgqgttvtvssast
    kgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
    slssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i7zC (C:)
    dlvltqspaslavslgqratiscrasksvstsgynymhwyqqkpgqppklliylasnlas
    gvparfsgsgsgtdftlnihpveeedaatyyclysrefppwtfgggtkleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i7zD (D:)
    qvqlqqsgpelkkpgetvkiscktsgysftnygmnwvkqapgkglkwmgwintytgepty
    addfrgrfafslatsastaylqiinlknedtatyfcetydsplgdywgqgttvtvssast
    kgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
    slssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc