PDB entry 1i7k

View 1i7k on RCSB PDB site
Description: crystal structure of human mitotic-specific ubiquitin-conjugating enzyme, ubch10
Deposited on 2001-03-09, released 2001-04-04
The last revision prior to the SCOP 1.57 freeze date was dated 2001-04-04, with a file datestamp of 2001-04-04.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.176
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1i7ka_
  • Chain 'B':
    Domains in SCOP 1.57: d1i7kb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i7kA (A:)
    pvgkrlqqelmtlmmsgdkgisafpesdnlfkwvgtihgaagtvyedlryklslefpsgy
    pynaptvkfltpcyhpnvdtqgnisldilkekwsalydvrtillsiqsllgepnidspln
    thaaelwknptafkkylqetyskqvt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i7kB (B:)
    pvgkrlqqelmtlmmsgdkgisafpesdnlfkwvgtihgaagtvyedlryklslefpsgy
    pynaptvkfltpcyhpnvdtqgnisldilkekwsalydvrtillsiqsllgepnidspln
    thaaelwknptafkkylqetyskqvt