PDB entry 1i7k

View 1i7k on RCSB PDB site
Description: crystal structure of human mitotic-specific ubiquitin-conjugating enzyme, ubch10
Class: ligase
Keywords: ubiquitin conjugating enzyme, LIGASE
Deposited on 2001-03-09, released 2001-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.176
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin-conjugating enzyme e2 h10
    Species: Homo sapiens [TaxId:9606]
    Gene: UBCH10
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00762
      • engineered (113)
    Domains in SCOPe 2.07: d1i7ka_
  • Chain 'B':
    Compound: ubiquitin-conjugating enzyme e2 h10
    Species: Homo sapiens [TaxId:9606]
    Gene: UBCH10
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00762
      • engineered (113)
    Domains in SCOPe 2.07: d1i7kb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i7kA (A:)
    masqnrdpaatsvaaarkgaepsggaargpvgkrlqqelmtlmmsgdkgisafpesdnlf
    kwvgtihgaagtvyedlryklslefpsgypynaptvkfltpcyhpnvdtqgnisldilke
    kwsalydvrtillsiqsllgepnidsplnthaaelwknptafkkylqetyskqvtsqep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i7kA (A:)
    pvgkrlqqelmtlmmsgdkgisafpesdnlfkwvgtihgaagtvyedlryklslefpsgy
    pynaptvkfltpcyhpnvdtqgnisldilkekwsalydvrtillsiqsllgepnidspln
    thaaelwknptafkkylqetyskqvt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1i7kB (B:)
    masqnrdpaatsvaaarkgaepsggaargpvgkrlqqelmtlmmsgdkgisafpesdnlf
    kwvgtihgaagtvyedlryklslefpsgypynaptvkfltpcyhpnvdtqgnisldilke
    kwsalydvrtillsiqsllgepnidsplnthaaelwknptafkkylqetyskqvtsqep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i7kB (B:)
    pvgkrlqqelmtlmmsgdkgisafpesdnlfkwvgtihgaagtvyedlryklslefpsgy
    pynaptvkfltpcyhpnvdtqgnisldilkekwsalydvrtillsiqsllgepnidspln
    thaaelwknptafkkylqetyskqvt