PDB entry 1i7d

View 1i7d on RCSB PDB site
Description: noncovalent complex of e.coli DNA topoisomerase III with an 8-base single-stranded DNA oligonucleotide
Class: isomerase/DNA
Keywords: DNA topoisomerase, decatenating enzyme, protein-DNA complex, single-stranded DNA, ISOMERASE/DNA COMPLEX
Deposited on 2001-03-08, released 2001-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.233
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA topoisomerase III
    Species: Escherichia coli [TaxId:562]
    Gene: TOPB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14294 (0-End)
      • engineered (327)
    Domains in SCOPe 2.07: d1i7da_
  • Chain 'B':
    Compound: 5'-d(*cp*gp*cp*ap*ap*cp*tp*t)-3'
  • Heterogens: CL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i7dA (A:)
    mrlfiaekpslaraiadvlpkphrkgdgfiecgngqvvtwcighlleqaqpdaydsryar
    wnladlpivpekwqlqprpsvtkqlnvikrflheaseivhagdpdregqllvdevldylq
    lapekrqqvqrclindlnpqaveraidrlrsnsefvplcvsalararadwlyginmtray
    tilgrnagyqgvlsvgrvqtpvlglvvrrdeeienfvakdffevkahivtpaderftaiw
    qpseacepyqdeegrllhrplaehvvnrisgqpaivtsyndkresesaplpfslsalqie
    aakrfglsaqnvldicqklyethklitfprsdcrylpeehfagrhavmnaisvhapdllp
    qpvvdpdirnrcwddkkvdahhaiiptarssainlteneakvynliarqylmqfcpdavf
    rkcvieldiakgkfvakarflaeagwrtllgskerdeendgtplpvvakgdellcekgev
    verqtqpprhftdatllsamtgiarfvqdkdlkkilratdglgteatragiiellfkrgf
    ltkkgryihstdagkalfhslpematrpdmtahwesvltqisekqcryqdfmqplvgtly
    qlidqakrtpvrqfrgivapgsggsadkkkaaprkrsakksppadevgsgaiahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i7dA (A:)
    mrlfiaekpslaraiadvlpkphrkgdgfiecgngqvvtwcighlleqaqpdaydsryar
    wnladlpivpekwqlqprpsvtkqlnvikrflheaseivhagdpdregqllvdevldylq
    lapekrqqvqrclindlnpqaveraidrlrsnsefvplcvsalararadwlyginmtray
    tilgrnagyqgvlsvgrvqtpvlglvvrrdeeienfvakdffevkahivtpaderftaiw
    qpseacepyqdeegrllhrplaehvvnrisgqpaivtsyndkresesaplpfslsalqie
    aakrfglsaqnvldicqklyethklitfprsdcrylpeehfagrhavmnaisvhapdllp
    qpvvdpdirnrcwddkkvdahhaiiptarssainlteneakvynliarqylmqfcpdavf
    rkcvieldiakgkfvakarflaeagwrtllgskerdeendgtplpvvakgdellcekgev
    verqtqpprhftdatllsamtgiarfvqdkdlkkilratdglgteatragiiellfkrgf
    ltkkgryihstdagkalfhslpematrpdmtahwesvltqisekqcryqdfmqplvgtly
    qlidqakrtpvrqfrgivap
    

  • Chain 'B':
    No sequence available.