PDB entry 1i77

View 1i77 on RCSB PDB site
Description: cytochrome c3 from desulfovibrio desulfuricans essex 6
Class: electron transport
Keywords: multi-heme cytochrome c, ELECTRON TRANSPORT
Deposited on 2001-03-08, released 2001-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.173
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c3
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1i77a_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i77A (A:)
    apaapdkplefkgsqktvmfphavhakvecvtchhqvdgkesfakcgssgchddlagkqg
    ekslyyvvhtkkelkhtncigchskvvegkpelkkdltacakskchp