PDB entry 1i76

View 1i76 on RCSB PDB site
Description: complex of 2-(biphenyl-4-sulfonyl)-1,2,3,4-tetrahydro-isoquinoline-3-carboxylic acid (d-tic derivative) with t catalitic domain of matrix metallo proteinase-8 (met80 form)
Class: hydrolase
Keywords: hydrolase, complex (metalloprotease/inhibitor)
Deposited on 2001-03-08, released 2001-03-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.132
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neutrophil collagenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1i76a_
  • Heterogens: CA, ZN, BSI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i76A (A:)
    mltpgnpkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadin
    iafyqrdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahef
    ghslglahssdpgalmypnyafretsnyslpqddidgiqaiyg