PDB entry 1i75

View 1i75 on RCSB PDB site
Description: crystal structure of cyclodextrin glucanotransferase from alkalophilic bacillus sp.#1011 complexed with 1-deoxynojirimycin
Class: transferase
Keywords: protein-inhibitor complex, transferase
Deposited on 2001-03-08, released 2001-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclodextrin glucanotransferase
    Species: Bacillus sp. [TaxId:1409]
    Gene: BACCGTA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05618 (0-685)
      • conflict (451)
      • conflict (453)
    Domains in SCOPe 2.07: d1i75a1, d1i75a2, d1i75a3, d1i75a4
  • Chain 'B':
    Compound: cyclodextrin glucanotransferase
    Species: Bacillus sp. [TaxId:1409]
    Gene: BACCGTA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05618 (0-685)
      • conflict (451)
      • conflict (453)
    Domains in SCOPe 2.07: d1i75b1, d1i75b2, d1i75b3, d1i75b4
  • Heterogens: CA, NOJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i75A (A:)
    apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgsctnlrlycggdwqgiink
    indgyltgmgitaiwisqpveniysvinysgvnntayhgywardfkktnpaygtmqdfkn
    lidtahahnikviidfapnhtspassddpsfaengrlydngnllggytndtqnlfhhygg
    tdfstiengiyknlydladlnhnnssvdvylkdaikmwldlgvdgirvdavkhmpfgwqk
    sfmatinnykpvftfgewflgvneispeyhqfanesgmslldfrfaqkarqvfrdntdnm
    yglkamlegsevdyaqvndqvtfidnhdmerfhtsngdrrkleqalaftltsrgvpaiyy
    gseqymsggndpdnrarlpsfsttttayqviqklaplrksnpaiaygstherwinndvii
    yerkfgnnvavvainrnmntpasitglvtslprgsyndvlggilngntltvgaggaasnf
    tlapggtavwqyttdattpiignvgpmmakpgvtitidgrgfgsgkgtvyfgttavtgad
    ivawedtqiqvkipavpggiydirvanaagaasniydnfevltgdqvtvrfvinnattal
    gqnvfltgnvselgnwdpnnaigpmynqvvyqyptwyydvsvpagqtiefkflkkqgstv
    twegganrtfttptsgtatvnvnwqp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i75B (B:)
    apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgsctnlrlycggdwqgiink
    indgyltgmgitaiwisqpveniysvinysgvnntayhgywardfkktnpaygtmqdfkn
    lidtahahnikviidfapnhtspassddpsfaengrlydngnllggytndtqnlfhhygg
    tdfstiengiyknlydladlnhnnssvdvylkdaikmwldlgvdgirvdavkhmpfgwqk
    sfmatinnykpvftfgewflgvneispeyhqfanesgmslldfrfaqkarqvfrdntdnm
    yglkamlegsevdyaqvndqvtfidnhdmerfhtsngdrrkleqalaftltsrgvpaiyy
    gseqymsggndpdnrarlpsfsttttayqviqklaplrksnpaiaygstherwinndvii
    yerkfgnnvavvainrnmntpasitglvtslprgsyndvlggilngntltvgaggaasnf
    tlapggtavwqyttdattpiignvgpmmakpgvtitidgrgfgsgkgtvyfgttavtgad
    ivawedtqiqvkipavpggiydirvanaagaasniydnfevltgdqvtvrfvinnattal
    gqnvfltgnvselgnwdpnnaigpmynqvvyqyptwyydvsvpagqtiefkflkkqgstv
    twegganrtfttptsgtatvnvnwqp