PDB entry 1i73

View 1i73 on RCSB PDB site
Description: complex of pro-leu-l-trp phosphonate with the catalitic domain of matrix metallo proteinase-8 (met80 form)
Deposited on 2001-03-07, released 2001-03-21
The last revision prior to the SCOP 1.59 freeze date was dated 2001-03-21, with a file datestamp of 2001-03-21.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.138
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1i73a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1i73A (A:)
mltpgnpkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadin
iafyqrdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahef
ghslglahssdpgalmypnyafretsnyslpqddidgiqaiyg