PDB entry 1i71

View 1i71 on RCSB PDB site
Description: high resolution crystal structure of apolipoprotein(a) kringle IV type 7: insights into ligand binding
Class: hydrolase
Keywords: alipoprotein(a), kringle, protein-ligand interaction, lysine binding, crystal structure, HYDROLASE
Deposited on 2001-03-07, released 2001-06-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.173
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apolipoprotein(a)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1i71a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i71A (A:)
    dcyhgdgqsyrgsfsttvtgrtcqswssmtphwhqrtteyypnggltrnycrnpdaeirp
    wcytmdpsvrweycnltqcpvme