PDB entry 1i70

View 1i70 on RCSB PDB site
Description: crystal structure of RNAse sa y86f mutant
Class: hydrolase
Keywords: mutant, hydrolase
Deposited on 2001-03-07, released 2001-09-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.131
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: guanyl-specific ribonuclease sa
    Species: Streptomyces aureofaciens [TaxId:1894]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05798 (0-95)
      • see remark 999 (71)
      • engineered (85)
    Domains in SCOPe 2.05: d1i70a_
  • Chain 'B':
    Compound: guanyl-specific ribonuclease sa
    Species: Streptomyces aureofaciens [TaxId:1894]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05798 (0-95)
      • see remark 999 (71)
      • engineered (85)
    Domains in SCOPe 2.05: d1i70b_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i70A (A:)
    dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
    gartrgtrriitgeatqedyytgdhfatfslidqtc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i70B (B:)
    dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
    gartrgtrriitgeatqedyytgdhfatfslidqtc