PDB entry 1i6z

View 1i6z on RCSB PDB site
Description: bag domain of bag1 cochaperone
Class: chaperone
Keywords: triple helix bundle, CHAPERONE
Deposited on 2001-03-06, released 2001-09-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bag-family molecular chaperone regulator-1
    Species: Mus musculus [TaxId:10090]
    Gene: BAG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q60739 (5-134)
      • cloning artifact (0-4)
    Domains in SCOPe 2.06: d1i6za1, d1i6za2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i6zA (A:)
    gspefmligeksnpeeevelkklkdlevsaekianhlqelnkelsgiqqgflakelqaea
    lckldrkvkatieqfmkileeidtmvlpeqfkdsrlkrknlvkkvqvflaecdtveqyic
    qeterlqstnlalae