PDB entry 1i6u

View 1i6u on RCSB PDB site
Description: RNA-protein interactions: the crystal structure of ribosomal protein s8/rRNA complex from methanococcus jannaschii
Class: ribosome
Keywords: protein-RNA interactions, ribosome, ribosomal protein S8, RNA, X-ray crystallography
Deposited on 2001-03-05, released 2001-08-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.218
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 30s ribosomal protein s8p
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJAS8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54041 (Start-129)
      • modified residue (40)
      • modified residue (110)
    Domains in SCOPe 2.04: d1i6ua_
  • Chain 'B':
    Compound: 30s ribosomal protein s8p
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJAS8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54041 (Start-129)
      • modified residue (40)
      • modified residue (110)
    Domains in SCOPe 2.04: d1i6ub_
  • Chain 'C':
    Compound: 16s rRNA fragment
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: 16s rRNA fragment
    Species: synthetic, synthetic
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i6uA (A:)
    mslmdplanalnhisncervgkkvvyikpaskligrvlkvmqdngyigefefiedgragi
    fkveligkinkcgaikprfpvkkfgyekfekrylpardfgilivsttqgvmsheeakkrg
    lggrllayvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i6uA (A:)
    slmdplanalnhisncervgkkvvyikpaskligrvlkvmqdngyigefefiedgragif
    kveligkinkcgaikprfpvkkfgyekfekrylpardfgilivsttqgvmsheeakkrgl
    ggrllayvy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1i6uB (B:)
    mslmdplanalnhisncervgkkvvyikpaskligrvlkvmqdngyigefefiedgragi
    fkveligkinkcgaikprfpvkkfgyekfekrylpardfgilivsttqgvmsheeakkrg
    lggrllayvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i6uB (B:)
    mdplanalnhisncervgkkvvyikpaskligrvlkvmqdngyigefefiedgragifkv
    eligkinkcgaikprfpvkkfgyekfekrylpardfgilivsttqgvmsheeakkrglgg
    rllayvy
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.