PDB entry 1i6p

View 1i6p on RCSB PDB site
Description: crystal structure of e. coli beta carbonic anhydrase (ecca)
Class: lyase
Keywords: carbonic anhydrase, metalloenzyme, zinc coordination, pH-dependent activity, MAD phasing, LYASE
Deposited on 2001-03-02, released 2001-05-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.176
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbonic anhydrase
    Species: Escherichia coli [TaxId:562]
    Gene: YADF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1i6pa_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i6pA (A:)
    mkdidtlisnnalwskmlveedpgffeklaqaqkprflwigcsdsrvpaerltglepgel
    fvhrnvanlvihtdlnclsvvqyavdvlevehiiicghygcggvqaavenpelglinnwl
    lhirdiwfkhssllgempqerrldtlcelnvmeqvynlghstimqsawkrgqkvtihgwa
    ygihdgllrdldvtatnretleqryrhgisnlklkhanhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i6pA (A:)
    kdidtlisnnalwskmlveedpgffeklaqaqkprflwigcsdsrvpaerltglepgelf
    vhrnvanlvihtdlnclsvvqyavdvlevehiiicghygcggvqaavenpelglinnwll
    hirdiwfkhssllgempqerrldtlcelnvmeqvynlghstimqsawkrgqkvtihgway
    gihdgllrdldvtatnretleqryrhgisnlklk