PDB entry 1i6n

View 1i6n on RCSB PDB site
Description: 1.8 a crystal structure of ioli protein with a binding zinc atom
Deposited on 2001-03-02, released 2002-03-13
The last revision prior to the SCOP 1.69 freeze date was dated 2002-03-13, with a file datestamp of 2002-03-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.201
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1i6na_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i6nA (A:)
    mklcfneattlensnlkldlelcekhgydyieirtmdklpeylkdhslddlaeyfqthhi
    kplalnalvffnnrdekghneiitefkgmmetcktlgvkyvvavplvteqkivkeeikks
    svdvltelsdiaepygvkialefvghpqctvntfeqayeivntvnrdnvglvldsfhfha
    mgsnieslkqadgkkifiyhiddtedfpigfltdedrvwpgqgaidldahlsalkeigfs
    dvvsvelfrpeyykltaeeaiqtakkttvdvvskyfsm