PDB entry 1i6m

View 1i6m on RCSB PDB site
Description: 1.7 high resolution experimental phases for tryptophanyl-trna synthetase complexed with tryptophanyl-5'amp
Deposited on 2001-03-02, released 2001-11-07
The last revision prior to the SCOP 1.71 freeze date was dated 2002-04-24, with a file datestamp of 2002-04-24.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: 0.225
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1i6ma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i6mA (A:)
    mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr
    laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagkeavsa
    glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg
    arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn
    llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl
    degaekanrvasemvrkmeqamglgrrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i6mA (A:)
    mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr
    laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagkeavsa
    glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg
    arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn
    llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl
    degaekanrvasemvrkmeqamglgr