PDB entry 1i6j

View 1i6j on RCSB PDB site
Description: crystal structure of a pseudo-16-mer dna with stacked guanines and two g-a mispairs complexed with the n-terminal fragment of moloney murine leukemia virus reverse transcriptase
Deposited on 2001-03-02, released 2001-09-07
The last revision prior to the SCOP 1.71 freeze date was dated 2001-09-07, with a file datestamp of 2001-09-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.225
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1i6ja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i6jA (A:)
    mtwlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiqrll
    dqgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptvpnpynllsglpps
    hqwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlfdea
    lhrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakkaqic
    qkqvkylgyllkegqr