PDB entry 1i6i

View 1i6i on RCSB PDB site
Description: crystal structure of the kif1a motor domain complexed with mg-amppcp
Deposited on 2001-03-02, released 2001-05-30
The last revision prior to the SCOP 1.59 freeze date was dated 2001-05-30, with a file datestamp of 2001-05-30.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.219
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1i6ia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i6iA (A:)
    gasvkvavrvrpfnsremsrdskciiqmsgstttivnpkqpketpksfsfdysywshtsp
    edinyasqkqvyrdigeemlqhafegynvcifaygqtgagksytmmgkqekdqqgiipql
    cedlfsrindttndnmsysvevsymeiycervrdllnpknkgnlrvrehpllgpyvedls
    klavtsyndiqdlmdsgnkartvaatnmnetssrshavfniiftqkrhdaetnittekvs
    kislvdlagseradstgakgtrlkeganinkslttlgkvisalaemdsgpnknkkkkktd
    fipyrdsvltwllrenlggnsrtamvaalspadinydetlstlryadrakqirntvsvnh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i6iA (A:)
    gasvkvavrvrpfnsremsrdskciiqmsgstttivnpkqpketpksfsfdysywshtsp
    edinyasqkqvyrdigeemlqhafegynvcifaygqtgagksytmmgkqekdqqgiipql
    cedlfsrindttndnmsysvevsymeiycervrdllnpknkgnlrvrehpllgpyvedls
    klavtsyndiqdlmdsgnkartvaatnmnetssrshavfniiftqkrhdaetnittekvs
    kislvdlagseaninkslttlgkvisalaemdfipyrdsvltwllrenlggnsrtamvaa
    lspadinydetlstlryadrakqirntvhhhhh