PDB entry 1i6e

View 1i6e on RCSB PDB site
Description: solution structure of the functional domain of paracoccus denitrificans cytochrome c552 in the oxidized state
Class: electron transport
Keywords: electron transport, cytochrome c552, heme, redox states, isotope enrichment {13c/15n}, nmr spectroscopy, solution structure
Deposited on 2001-03-02, released 2001-10-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c552
  Species: Paracoccus denitrificans [TaxId:266]
  Gene: CYCM
  Database cross-references and differences (RAF-indexed):
  • Uniprot P54820 (1-99)
    • see remark 999 (0)
  Domains in SCOPe 2.06: d1i6ea_
• Heterogens: HEC

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1i6eA (A:)
  madpaagekvfgkckachkldgndgvgphlngvvgrtvagvdgfnysdpmkahggdwtpe
  alqefltnpkavvkgtkmafaglpkiedranliaylegqq