PDB entry 1i60

View 1i60 on RCSB PDB site
Description: structural genomics, ioli protein
Deposited on 2001-03-01, released 2002-03-13
The last revision prior to the SCOP 1.69 freeze date was dated 2002-03-13, with a file datestamp of 2002-03-13.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.214
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1i60a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i60A (A:)
    mklcfneattlensnlkldlelcekhgydyieirtmdklpeylkdhslddlaeyfqthhi
    kplalnalvffnnrdekghneiitefkgmmetcktlgvkyvvavplvteqkivkeeikks
    svdvltelsdiaepygvkialefvghpqctvntfeqayeivntvnrdnvglvldsfhfha
    mgsnieslkqadgkkifiyhiddtedfpigfltdedrvwpgqgaidldahlsalkeigfs
    dvvsvelfrpeyykltaeeaiqtakkttvdvvskyfsm