PDB entry 1i60

View 1i60 on RCSB PDB site
Description: Structural genomics, IOLI protein
Class: structural genomics, unknown function
Keywords: Beta barrel, structural genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2001-03-01, released 2002-03-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ioli protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: IOLI OR B65B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42419 (0-277)
      • modified residue (0)
      • modified residue (35)
      • modified residue (88-89)
      • modified residue (180)
      • modified residue (277)
    Domains in SCOPe 2.08: d1i60a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1i60A (A:)
mklcfneattlensnlkldlelcekhgydyieirtmdklpeylkdhslddlaeyfqthhi
kplalnalvffnnrdekghneiitefkgmmetcktlgvkyvvavplvteqkivkeeikks
svdvltelsdiaepygvkialefvghpqctvntfeqayeivntvnrdnvglvldsfhfha
mgsnieslkqadgkkifiyhiddtedfpigfltdedrvwpgqgaidldahlsalkeigfs
dvvsvelfrpeyykltaeeaiqtakkttvdvvskyfsm