PDB entry 1i5z

View 1i5z on RCSB PDB site
Description: structure of crp-camp at 1.9 a
Class: DNA binding protein
Keywords: CAMP receptor Protein (CRP), Allostery, DNA binding Cyclic AMP, Transcription Regulation, CATABOLITE ACTIVATOR PROTEIN (CAP), DNA BINDING PROTEIN
Deposited on 2001-03-01, released 2003-06-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.215
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: catabolite gene activator protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1i5za1, d1i5za2
  • Chain 'B':
    Compound: catabolite gene activator protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1i5zb1, d1i5zb2
  • Heterogens: TRS, CMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i5zA (A:)
    vlgkpqtdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemi
    lsylnqgdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqm
    arrlqvtsekvgnlafldvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsr
    etvgrilkmledqnlisahgktivvygtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i5zA (A:)
    qtdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsyln
    qgdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlq
    vtsekvgnlafldvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgr
    ilkmledqnlisahgktivvy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1i5zB (B:)
    vlgkpqtdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemi
    lsylnqgdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqm
    arrlqvtsekvgnlafldvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsr
    etvgrilkmledqnlisahgktivvygtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i5zB (B:)
    vlgkpqtdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemi
    lsylnqgdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqm
    arrlqvtsekvgnlafldvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsr
    etvgrilkmledqnlisahgktivvyg