PDB entry 1i5u

View 1i5u on RCSB PDB site
Description: solution structure of cytochrome b5 triple mutant (e48a/e56a/d60a)
Class: electron transport
Keywords: Electron transport, Transmembrane, Heme, Microsome
Deposited on 2001-02-28, released 2001-03-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome b5
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00171 (0-81)
      • engineered (45)
      • engineered (53)
      • engineered (57)
    Domains in SCOPe 2.06: d1i5ua_
  • Heterogens: HEM

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1i5uA (A:)
avkyytleeiqkhnnskstwlilhykvydltkfleehpggeevlraqaggdatanfeavg
hstdarelsktfiigelhpddr