PDB entry 1i5o

View 1i5o on RCSB PDB site
Description: crystal structure of mutant r105a of e. coli aspartate transcarbamoylase
Class: transferase
Keywords: Mutant aspartate transcarbamoylase, T-state, PALA at the regulatory site, TRANSFERASE
Deposited on 2001-02-28, released 2001-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.155
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate transcarbamoylase catalytic chain
    Species: Escherichia coli [TaxId:562]
    Gene: PYRB, PYRI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A786 (0-309)
      • engineered (104)
    Domains in SCOPe 2.07: d1i5oa1, d1i5oa2
  • Chain 'B':
    Compound: aspartate transcarbamoylase regulatory chain
    Species: Escherichia coli [TaxId:562]
    Gene: PYRB, PYRI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1i5ob1, d1i5ob2
  • Chain 'C':
    Compound: aspartate transcarbamoylase catalytic chain
    Species: Escherichia coli [TaxId:562]
    Gene: PYRB, PYRI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A786 (0-309)
      • engineered (104)
    Domains in SCOPe 2.07: d1i5oc1, d1i5oc2
  • Chain 'D':
    Compound: aspartate transcarbamoylase regulatory chain
    Species: Escherichia coli [TaxId:562]
    Gene: PYRB, PYRI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1i5od1, d1i5od2
  • Heterogens: ZN, PAL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i5oA (A:)
    anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
    tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmahpqegaarlatefsg
    nvpvlnagdgsnqhptqtlldlftiqetqgrldnlhvamvgdlkygrtvhsltqalakfd
    gnrfyfiapdalampqyildmldekgiawslhssieevmaevdilymtrvqkerldpsey
    anvkaqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawyfqqagngifarqall
    alvlnrdlvl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i5oB (B:)
    mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
    ientflsedqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaep
    vsssfavrkrandialkckycekefshnvvlan
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i5oC (C:)
    anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
    tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmahpqegaarlatefsg
    nvpvlnagdgsnqhptqtlldlftiqetqgrldnlhvamvgdlkygrtvhsltqalakfd
    gnrfyfiapdalampqyildmldekgiawslhssieevmaevdilymtrvqkerldpsey
    anvkaqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawyfqqagngifarqall
    alvlnrdlvl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i5oD (D:)
    mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
    ientflsedqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaep
    vsssfavrkrandialkckycekefshnvvlan