PDB entry 1i5k

View 1i5k on RCSB PDB site
Description: structure and binding determinants of the recombinant kringle-2 domain of human plasminogen to an internal peptide from a group a streptococcal surface protein
Class: blood clotting
Keywords: Human Plasminogen Kringle-2, Kringles, VEK-30, BLOOD CLOTTING
Deposited on 2001-02-27, released 2001-08-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.195
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plasminogen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00747
      • engineered (7)
      • engineered (59)
      • engineered (75)
    Domains in SCOPe 2.06: d1i5ka_
  • Chain 'B':
    Compound: plasminogen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00747 (3-End)
      • cloning artifact (2)
      • engineered (7)
      • engineered (59)
      • engineered (75)
    Domains in SCOPe 2.06: d1i5kb1, d1i5kb2
  • Chain 'C':
    Compound: m protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: m protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i5kA (A:)
    fseecmhgsgenydgkisktmsglecqawdsqsphahgyipskfpnknlkknycrnpdrd
    lrpwcfttdpnkrweycdiprcaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i5kA (A:)
    ecmhgsgenydgkisktmsglecqawdsqsphahgyipskfpnknlkknycrnpdrdlrp
    wcfttdpnkrweycdiprc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1i5kB (B:)
    fseecmhgsgenydgkisktmsglecqawdsqsphahgyipskfpnknlkknycrnpdrd
    lrpwcfttdpnkrweycdiprcaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i5kB (B:)
    eecmhgsgenydgkisktmsglecqawdsqsphahgyipskfpnknlkknycrnpdrdlr
    pwcfttdpnkrweycdiprc
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.