PDB entry 1i5k

View 1i5k on RCSB PDB site
Description: structure and binding determinants of the recombinant kringle-2 domain of human plasminogen to an internal peptide from a group a streptococcal surface protein
Deposited on 2001-02-27, released 2001-08-01
The last revision prior to the SCOP 1.57 freeze date was dated 2001-08-01, with a file datestamp of 2001-08-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.195
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1i5ka_
  • Chain 'B':
    Domains in SCOP 1.57: d1i5kb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i5kA (A:)
    ecmhgsgenydgkisktmsglecqawdsqsphahgyipskfpnknlkknycrnpdrdlrp
    wcfttdpnkrweycdiprc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i5kB (B:)
    eecmhgsgenydgkisktmsglecqawdsqsphahgyipskfpnknlkknycrnpdrdlr
    pwcfttdpnkrweycdiprc