PDB entry 1i5h

View 1i5h on RCSB PDB site
Description: solution structure of the rnedd4 wwiii domain-renac bp2 peptide complex
Class: ligase
Keywords: Nedd4, WW domains, ENaC, PY Motif, Liddle syndrome, NMR, proline-rich
Deposited on 2001-02-27, released 2001-05-02
The last revision prior to the SCOP 1.75 freeze date was dated 2001-05-02, with a file datestamp of 2007-06-04.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'B':
  Compound: amiloride-sensitive sodium channel beta-subunit
  Species: Rattus norvegicus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P37090 (2-16)
    • see remark 999 (0-1)
• Chain 'W':
  Compound: ubiquitin ligase nedd4
  Species: Rattus norvegicus
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q62940 (2-49)
    • see remark 999 (0-1)
  Domains in SCOP 1.75: d1i5hw_

PDB Chain Sequences:

• Chain 'B':
  No sequence available.
  
  
• Chain 'W':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1i5hW (W:)
  gspvdsndlgplppgweerthtdgrvffinhnikktqwedprmqnvaitg