PDB entry 1i5h

View 1i5h on RCSB PDB site
Description: solution structure of the rnedd4 wwiii domain-renal bp2 peptide complex
Deposited on 2001-02-27, released 2001-05-02
The last revision prior to the SCOP 1.57 freeze date was dated 2001-05-02, with a file datestamp of 2001-05-02.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'W':
    Domains in SCOP 1.57: d1i5hw_

PDB Chain Sequences:

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i5hW (W:)
    gspvdsndlgplppgweerthtdgrvffinhnikktqwedprmqnvaitg