PDB entry 1i5f

View 1i5f on RCSB PDB site
Description: bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability
Class: transcription
Keywords: Beta barrel, Homodimer
Deposited on 2001-02-27, released 2001-11-07
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.14
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cold-shock protein cspb
  Species: Bacillus caldolyticus
  Gene: cspB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P41016 (0-65)
    • engineered (2)
  Domains in SCOP 1.73: d1i5fa_
• Chain 'B':
  Compound: cold-shock protein cspb
  Species: Bacillus caldolyticus
  Gene: cspB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P41016 (0-65)
    • engineered (2)
  Domains in SCOP 1.73: d1i5fb_
• Heterogens: NA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1i5fA (A:)
  mqegkvkwfnnekgygfieveggsdvfvhftaiqgegfktleegqevsfeivqgnrgpqa
  anvvkl
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1i5fB (B:)
  mqegkvkwfnnekgygfieveggsdvfvhftaiqgegfktleegqevsfeivqgnrgpqa
  anvvkl