PDB entry 1i5e

View 1i5e on RCSB PDB site
Description: crystal structure of bacillus caldolyticus uracil phosphoribosyltransferase with bound ump
Deposited on 2001-02-27, released 2002-06-05
The last revision prior to the SCOP 1.61 freeze date was dated 2002-06-05, with a file datestamp of 2002-06-05.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.223
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1i5ea_
  • Chain 'B':
    Domains in SCOP 1.61: d1i5eb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i5eA (A:)
    gkvyvfdhpliqhkltyirdkntgtkefrelvdevatlmafeitrdlpleeveietpvsk
    arakviagkklgvipilragigmvdgilklipaakvghiglyrdpqtlkpveyyvklpsd
    veerdfiivdpmlatggsavaaidalkkrgaksikfmcliaapegvkavetahpdvdiyi
    aalderlndhgyivpglgdagdrlfgtk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i5eB (B:)
    gkvyvfdhpliqhkltyirdkntgtkefrelvdevatlmafeitrdlpleeveietpvsk
    arakviagkklgvipilragigmvdgilklipaakvghiglyrdpqtlkpveyyvklpsd
    veerdfiivdpmlatggsavaaidalkkrgaksikfmcliaapegvkavetahpdvdiyi
    aalderlndhgyivpglgdagdrlfgtk