PDB entry 1i58

View 1i58 on RCSB PDB site
Description: structure of the histidine kinase chea ATP-binding domain in complex with ATP analog adpcp and magnesium
Class: signaling protein, transferase
Keywords: beta-alpha sandwich, SIGNALING PROTEIN, TRANSFERASE
Deposited on 2001-02-26, released 2001-08-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.223
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chemotaxis protein chea
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q56310 (0-188)
      • engineered (0-2)
    Domains in SCOPe 2.08: d1i58a_
  • Chain 'B':
    Compound: chemotaxis protein chea
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q56310 (Start-188)
      • engineered (2)
    Domains in SCOPe 2.08: d1i58b_
  • Heterogens: ACT, MG, ACP, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i58A (A:)
    gshmvpisfvfnrfprmvrdlakkmnkevnfimrgedteldrtfveeigepllhllrnai
    dhgiepkeeriakgkppigtlilsarhegnnvvieveddgrgidkekiirkaiekglide
    skaatlsdqeilnflfvpgfstkekvsevsgrgvgmdvvknvveslngsisiesekdkgt
    kvtirlplt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1i58B (B:)
    gshmvpisfvfnrfprmvrdlakkmnkevnfimrgedteldrtfveeigepllhllrnai
    dhgiepkeeriakgkppigtlilsarhegnnvvieveddgrgidkekiirkaiekglide
    skaatlsdqeilnflfvpgfstkekvsevsgrgvgmdvvknvveslngsisiesekdkgt
    kvtirlplt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i58B (B:)
    hmvpisfvfnrfprmvrdlakkmnkevnfimrgedteldrtfveeigepllhllrnaidh
    giepkeeriakgkppigtlilsarhegnnvvieveddgrgidkekiirkaiekglidesk
    aatlsdqeilnflfvpgfsvgmdvvknvveslngsisiesekdkgtkvtirlplt