PDB entry 1i56

View 1i56 on RCSB PDB site
Description: solution structure of ca2+-bound state of canine milk lysozyme
Class: hydrolase
Keywords: calcium binding lysozyme, enzyme, hydrolase
Deposited on 2001-02-25, released 2002-02-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme C
    Species: Canis lupus familiaris [TaxId:9615]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81708 (1-129)
      • cloning artifact (0)
    Domains in SCOPe 2.03: d1i56a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i56A (A:)
    skifskcelarklksmgmdgfhgyslanwvcmaeyesnfntqafngrnsngssdygifql
    nskwwcksnshssanacnimcskflddnidddiacakrvvkdpngmsawvawvkhckgkd
    lskylascnl