PDB entry 1i56

View 1i56 on RCSB PDB site
Description: solution structure of ca2+-bound state of canine milk lysozyme
Class: hydrolase
Keywords: calcium binding lysozyme, enzyme
Deposited on 2001-02-25, released 2002-02-27
The last revision prior to the SCOP 1.75 freeze date was dated 2002-02-27, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme C
    Species: Canis familiaris
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81708 (1-129)
      • cloning artifact (0)
    Domains in SCOP 1.75: d1i56a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i56A (A:)
    skifskcelarklksmgmdgfhgyslanwvcmaeyesnfntqafngrnsngssdygifql
    nskwwcksnshssanacnimcskflddnidddiacakrvvkdpngmsawvawvkhckgkd
    lskylascnl