PDB entry 1i55

View 1i55 on RCSB PDB site
Description: cytochrome c (tuna) with 2zn:1fe mixed-metal porphyrins
Class: electron transport
Keywords: cytochrome c, electron transfer, zinc-porphyrin, ELECTRON TRANSPORT
Deposited on 2001-02-24, released 2001-05-09
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.218
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c
    Species: Thunnus thynnus [TaxId:8237]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1i55a_
  • Chain 'B':
    Compound: cytochrome c
    Species: Thunnus thynnus [TaxId:8237]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1i55b_
  • Heterogens: HEM, ZNH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i55A (A:)
    gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
    ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i55B (B:)
    gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
    ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats