PDB entry 1i55

View 1i55 on RCSB PDB site
Description: cytochrome c (tuna) with 2zn:1fe mixed-metal porphyrins
Deposited on 2001-02-24, released 2001-05-09
The last revision prior to the SCOP 1.57 freeze date was dated 2001-05-09, with a file datestamp of 2001-05-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.218
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1i55a_
  • Chain 'B':
    Domains in SCOP 1.57: d1i55b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1i55A (A:)
gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1i55B (B:)
gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats