PDB entry 1i53

View 1i53 on RCSB PDB site
Description: re(I)-tricarbonly diimine (q107h)) azurin
Class: electron transport
Keywords: azurin, rhenium, electron transfer, tyrosyl and tryptophan radical, ELECTRON TRANSPORT
Deposited on 2001-02-24, released 2001-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.238
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • conflict (1)
      • conflict (82)
      • engineered (106)
    Domains in SCOPe 2.07: d1i53a_
  • Chain 'B':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • conflict (1)
      • conflict (82)
      • engineered (106)
    Domains in SCOPe 2.07: d1i53b_
  • Heterogens: CU, RTC, DPT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i53A (A:)
    aqcsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviaqtkligsgekdsvtfdvsklkegehymffctfpghsal
    mkgtltlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i53B (B:)
    aqcsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviaqtkligsgekdsvtfdvsklkegehymffctfpghsal
    mkgtltlk