PDB entry 1i52

View 1i52 on RCSB PDB site
Description: crystal structure of 4-diphosphocytidyl-2-c-methylerythritol (cdp-me) synthase (ygbp) involved in mevalonate independent isoprenoid biosynthesis
Deposited on 2001-02-23, released 2001-07-11
The last revision prior to the SCOP 1.59 freeze date was dated 2001-07-11, with a file datestamp of 2001-07-11.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.227
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1i52a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i52A (A:)
    hldvcavvpaagfgrrmqtecpkqylsignqtilehsvhallahprvkrvviaispgdsr
    faqlplanhpqitvvdggderadsvlaglkaagdaqwvlvhdaarpclhqddlarllals
    etsrtggilaapvrdtmkraepgknaiahtvdrnglwhaltpqffprellhdcltralne
    gatitdeasaleycgfhpqlvegradnikvtrpedlalaefyltr