PDB entry 1i52

View 1i52 on RCSB PDB site
Description: crystal structure of 4-diphosphocytidyl-2-c-methylerythritol (cdp-me) synthase (ygbp) involved in mevalonate independent isoprenoid biosynthesis
Class: transferase
Keywords: cytidylyltransferase, deoxyxylulose-5-phosphate pathway (dxp), isoprenoid biosynthesys, mep, transferase
Deposited on 2001-02-23, released 2001-07-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.227
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-diphosphocytidyl-2-c-methylerythritol synthase
    Species: Escherichia coli [TaxId:83333]
    Gene: ISPD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1i52a_
  • Heterogens: CA, MG, CTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i52A (A:)
    matthldvcavvpaagfgrrmqtecpkqylsignqtilehsvhallahprvkrvviaisp
    gdsrfaqlplanhpqitvvdggderadsvlaglkaagdaqwvlvhdaarpclhqddlarl
    lalsetsrtggilaapvrdtmkraepgknaiahtvdrnglwhaltpqffprellhdcltr
    alnegatitdeasaleycgfhpqlvegradnikvtrpedlalaefyltrtihqent
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i52A (A:)
    hldvcavvpaagfgrrmqtecpkqylsignqtilehsvhallahprvkrvviaispgdsr
    faqlplanhpqitvvdggderadsvlaglkaagdaqwvlvhdaarpclhqddlarllals
    etsrtggilaapvrdtmkraepgknaiahtvdrnglwhaltpqffprellhdcltralne
    gatitdeasaleycgfhpqlvegradnikvtrpedlalaefyltr